Product Number |
ARP63131_P050-FITC |
Product Page |
www.avivasysbio.com/adck2-antibody-middle-region-fitc-arp63131-p050-fitc.html |
Name |
ADCK2 Antibody - middle region : FITC (ARP63131_P050-FITC) |
Protein Size (# AA) |
626 amino acids |
Molecular Weight |
68kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
90956 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
AARF |
Peptide Sequence |
Synthetic peptide located within the following region: LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr) |
Protein Interactions |
UBC; YWHAQ; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-ADCK2 (ARP63131_P050-FITC) antibody |
Blocking Peptide |
For anti-ADCK2 (ARP63131_P050-FITC) antibody is Catalog # AAP63131 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human ADCK2 |
Uniprot ID |
Q7Z695 |
Protein Name |
Uncharacterized aarF domain-containing protein kinase 2 |
Sample Type Confirmation |
ADCK2 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_443085 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_052853 |
Gene Symbol |
ADCK2 |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | |
|