| Product Number |
ARP63131_P050 |
| Product Page |
www.avivasysbio.com/adck2-antibody-middle-region-arp63131-p050.html |
| Name |
ADCK2 Antibody - middle region (ARP63131_P050) |
| Protein Size (# AA) |
626 amino acids |
| Molecular Weight |
68kDa |
| NCBI Gene Id |
90956 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
AARF |
| Peptide Sequence |
Synthetic peptide located within the following region: LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr) |
| Protein Interactions |
UBC; YWHAQ; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ADCK2 (ARP63131_P050) antibody |
| Blocking Peptide |
For anti-ADCK2 (ARP63131_P050) antibody is Catalog # AAP63131 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human ADCK2 |
| Uniprot ID |
Q7Z695 |
| Protein Name |
Uncharacterized aarF domain-containing protein kinase 2 |
| Sample Type Confirmation |
ADCK2 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_443085 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_052853 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ADCK2 |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Adult Liver
 | Rabbit Anti-ADCK2 Antibody
Catalog Number: ARP63131_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Membrane in bile canaliculi, strong signal, wide tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: donkey anti-rabbit FITC
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
| | Image 2 | Human Jurkat
 | Host: Rabbit
Target Name: ADCK2
Sample Type: Jurkat Whole Cell lysates
Antibody Dilution: 1.0ug/mlADCK2 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
|
