Product Number |
ARP63128_P050 |
Product Page |
www.avivasysbio.com/aadacl3-antibody-c-terminal-region-arp63128-p050.html |
Name |
AADACL3 Antibody - C-terminal region (ARP63128_P050) |
Protein Size (# AA) |
350 amino acids |
Molecular Weight |
40kDa |
NCBI Gene Id |
126767 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Arylacetamide deacetylase-like 3 |
Alias Symbols |
RP11-474O21.3 |
Peptide Sequence |
Synthetic peptide located within the following region: YRKWLGPENIPERFKERGYQLKPHEPMNEAAYLEVSVVLDVMCSPLIAED |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-AADACL3 (ARP63128_P050) antibody |
Blocking Peptide |
For anti-AADACL3 (ARP63128_P050) antibody is Catalog # AAP63128 |
Uniprot ID |
Q5VUY0 |
Protein Name |
Arylacetamide deacetylase-like 3 |
Protein Accession # |
NP_001096640 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001103170 |
Tested Species Reactivity |
Human |
Gene Symbol |
AADACL3 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human HeLa
| WB Suggested Anti-AADACL3 Antibody Titration: 1.0 ug/ml Positive Control: Hela Whole Cell |
|
|