| Product Number |
ARP63067_P050 |
| Product Page |
www.avivasysbio.com/cd33-antibody-n-terminal-region-arp63067-p050.html |
| Name |
CD33 Antibody - N-terminal region (ARP63067_P050) |
| Protein Size (# AA) |
364 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
945 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
CD33 molecule |
| Alias Symbols |
p67, SIGLEC3, SIGLEC-3 |
| Peptide Sequence |
Synthetic peptide located within the following region: HPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
CD33 is a putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. CD33 preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, CD33 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. CD33 induces apoptosis in acute myeloid leukemia (in vitro). |
| Protein Interactions |
KRT40; KRT31; HERC3; UBC; CBL; SRC; PTPN6; PTPN11; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CD33 (ARP63067_P050) antibody |
| Blocking Peptide |
For anti-CD33 (ARP63067_P050) antibody is Catalog # AAP63067 |
| Uniprot ID |
P20138 |
| Protein Name |
Myeloid cell surface antigen CD33 |
| Protein Accession # |
NP_001763 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001772 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CD33 |
| Predicted Species Reactivity |
Human, Cow, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Horse: 79%; Human: 100% |
| Image 1 | Human Fetal heart
 | WB Suggested Anti-CD33 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart |
|
|
