SLC50A1 Antibody - C-terminal region (ARP62908_P050)

Data Sheet
 
Product Number ARP62908_P050
Product Page www.avivasysbio.com/slc50a1-antibody-c-terminal-region-arp62908-p050.html
Name SLC50A1 Antibody - C-terminal region (ARP62908_P050)
Protein Size (# AA) 221 amino acids
Molecular Weight 24kDa
NCBI Gene Id 55974
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Solute carrier family 50 (sugar transporter), member 1
Alias Symbols SCP, slv, SWEET1, RAG1AP1, HsSWEET1
Peptide Sequence Synthetic peptide located within the following region: SMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target SLC50A1 mediates sugar transport across membranes. It may stimulate V(D)J recombination by the activation of RAG1.
Protein Interactions ELAVL1; TRPV2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SLC50A1 (ARP62908_P050) antibody
Blocking Peptide For anti-SLC50A1 (ARP62908_P050) antibody is Catalog # AAP62908
Uniprot ID Q9BRV3
Protein Name Sugar transporter SWEET1
Sample Type Confirmation

SLC50A1 is supported by BioGPS gene expression data to be expressed in MCF7

Protein Accession # NP_061333
Purification Affinity Purified
Nucleotide Accession # NM_018845
Tested Species Reactivity Human
Gene Symbol SLC50A1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 91%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 86%; Rat: 86%
Image 1
Human MCF-7
WB Suggested Anti-SLC50A1 Antibody
Titration: 1.0 ug/ml
Positive Control: MCF7 Whole CellSLC50A1 is supported by BioGPS gene expression data to be expressed in MCF7
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com