FBXL8 Antibody - N-terminal region (ARP62815_P050)

Data Sheet
 
Product Number ARP62815_P050
Product Page www.avivasysbio.com/fbxl8-antibody-n-terminal-region-arp62815-p050.html
Name FBXL8 Antibody - N-terminal region (ARP62815_P050)
Protein Size (# AA) 374 amino acids
Molecular Weight 40kDa
NCBI Gene Id 55336
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name F-box and leucine-rich repeat protein 8
Alias Symbols FBL8
Peptide Sequence Synthetic peptide located within the following region: ECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class. It shares 78% sequence identity with the mouse protein.
Protein Interactions SKP1; ORC4; HSP90AA1; CUL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FBXL8 (ARP62815_P050) antibody
Blocking Peptide For anti-FBXL8 (ARP62815_P050) antibody is Catalog # AAP62815
Uniprot ID Q96CD0
Protein Name F-box/LRR-repeat protein 8
Protein Accession # NP_060848
Purification Affinity Purified
Nucleotide Accession # NM_018378
Tested Species Reactivity Human
Gene Symbol FBXL8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 92%; Rat: 86%
Image 1
Human Jurkat
WB Suggested Anti-FBXL8 Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com