Dnajc21 Antibody - middle region (ARP62801_P050)

Data Sheet
 
Product Number ARP62801_P050
Product Page www.avivasysbio.com/dnajc21-antibody-middle-region-arp62801-p050.html
Name Dnajc21 Antibody - middle region (ARP62801_P050)
Protein Size (# AA) 531 amino acids
Molecular Weight 58kDa
NCBI Gene Id 78244
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name DnaJ (Hsp40) homolog, subfamily C, member 21
Alias Symbols 4930461P20Rik, 9930116P15Rik
Peptide Sequence Synthetic peptide located within the following region: FYAHWQSFCTQKNFSWKEEYDTRQASNRWEKRAMEKENKKIRDRARKEKN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Dnajc21 (ARP62801_P050) antibody
Blocking Peptide For anti-Dnajc21 (ARP62801_P050) antibody is Catalog # AAP62801
Uniprot ID E9Q8D0
Protein Name Protein Dnajc21 Ensembl ENSMUSP00000116865
Protein Accession # NP_084322
Purification Affinity Purified
Nucleotide Accession # NM_030046
Tested Species Reactivity Mouse
Gene Symbol Dnajc21
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 92%
Image 1
Mouse Small Intestine
WB Suggested Anti-Dnajc21 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Small Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com