| Product Number |
ARP62773_P050 |
| Product Page |
www.avivasysbio.com/ldah-antibody-c-terminal-region-arp62773-p050.html |
| Name |
LDAH Antibody - C-terminal region (ARP62773_P050) |
| Protein Size (# AA) |
325 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
60526 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
lipid droplet associated hydrolase |
| Alias Symbols |
hLDAH, C2orf43 |
| Peptide Sequence |
Synthetic peptide located within the following region: TIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPHAFIT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LDAH (ARP62773_P050) antibody |
| Blocking Peptide |
For anti-LDAH (ARP62773_P050) antibody is Catalog # AAP62773 |
| Uniprot ID |
Q9H6V9 |
| Protein Name |
lipid droplet-associated hydrolase |
| Sample Type Confirmation |
C2orf43 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_068744 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_021925 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LDAH |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 91%; Pig: 86%; Rabbit: 100%; Rat: 89% |
| Image 1 | Human Adult Liver
 | Rabbit Anti-C2orf43 Antibody
Catalog Number: ARP62773_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Membrane, Cytoplasm in hepatocytes, moderate signal, moderate tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
| Image 2 | Human HepG2
 | Host: Rabbit
Target Name: C2orf43
Sample Type: Human HepG2
Antibody Dilution: 1.0ug/mlC2orf43 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells |
|
| Image 3 | Human Fetal Lung
 | Host: Rabbit
Target Name: C2orf43
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml |
|
| Image 4 | Human Placenta
 | WB Suggested Anti-C2orf43 Antibody
Titration: 1.0 ug/ml
Positive Control: Placenta |
|
