BRAT1 Antibody - C-terminal region (ARP62762_P050)

Data Sheet
 
Product Number ARP62762_P050
Product Page www.avivasysbio.com/brat1-antibody-c-terminal-region-arp62762-p050.html
Name BRAT1 Antibody - C-terminal region (ARP62762_P050)
Protein Size (# AA) 821 amino acids
Molecular Weight 87kDa
NCBI Gene Id 221927
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name BRCA1-associated ATM activator 1
Alias Symbols BAAT1, RMFSL, NEDCAS, C7orf27
Peptide Sequence Synthetic peptide located within the following region: FDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this ubiquitously expressed gene interacts with the tumor suppressing BRCA1 (breast cancer 1) protein and and the ATM (ataxia telangiectasia mutated) protein. ATM is thought to be a master controller of cell cycle checkpoint signalling pathways that are required for cellular responses to DNA damage such as double-strand breaks that are induced by ionizing radiation and complexes with BRCA1 in the multi-protein complex BASC (BRAC1-associated genome surveillance complex). The protein encoded by this gene is thought to play a role in the DNA damage pathway regulated by BRCA1 and ATM.
Protein Interactions UBC; BRCA1; USP48; VCP; ATM; SUMO2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BRAT1 (ARP62762_P050) antibody
Blocking Peptide For anti-BRAT1 (ARP62762_P050) antibody is Catalog # AAP62762
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human BRAT1
Uniprot ID Q6PJG6
Protein Name BRCA1-associated ATM activator 1
Protein Accession # NP_689956
Purification Affinity Purified
Nucleotide Accession # NM_152743
Tested Species Reactivity Human
Gene Symbol BRAT1
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HepG2
WB Suggested Anti-BRAT1 Antibody
Titration: 1.0 ug/ml
Positive Control: HepG2 Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com