Product Number |
ARP62762_P050 |
Product Page |
www.avivasysbio.com/brat1-antibody-c-terminal-region-arp62762-p050.html |
Name |
BRAT1 Antibody - C-terminal region (ARP62762_P050) |
Protein Size (# AA) |
821 amino acids |
Molecular Weight |
87kDa |
NCBI Gene Id |
221927 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
BRCA1-associated ATM activator 1 |
Alias Symbols |
BAAT1, RMFSL, NEDCAS, C7orf27 |
Peptide Sequence |
Synthetic peptide located within the following region: FDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this ubiquitously expressed gene interacts with the tumor suppressing BRCA1 (breast cancer 1) protein and and the ATM (ataxia telangiectasia mutated) protein. ATM is thought to be a master controller of cell cycle checkpoint signalling pathways that are required for cellular responses to DNA damage such as double-strand breaks that are induced by ionizing radiation and complexes with BRCA1 in the multi-protein complex BASC (BRAC1-associated genome surveillance complex). The protein encoded by this gene is thought to play a role in the DNA damage pathway regulated by BRCA1 and ATM. |
Protein Interactions |
UBC; BRCA1; USP48; VCP; ATM; SUMO2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-BRAT1 (ARP62762_P050) antibody |
Blocking Peptide |
For anti-BRAT1 (ARP62762_P050) antibody is Catalog # AAP62762 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human BRAT1 |
Uniprot ID |
Q6PJG6 |
Protein Name |
BRCA1-associated ATM activator 1 |
Protein Accession # |
NP_689956 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_152743 |
Tested Species Reactivity |
Human |
Gene Symbol |
BRAT1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-BRAT1 Antibody Titration: 1.0 ug/ml Positive Control: HepG2 Whole Cell |
|
|