AZI2 Antibody - middle region (ARP62739_P050)

Data Sheet
 
Product Number ARP62739_P050
Product Page www.avivasysbio.com/azi2-antibody-middle-region-arp62739-p050.html
Name AZI2 Antibody - middle region (ARP62739_P050)
Protein Size (# AA) 392 amino acids
Molecular Weight 43kDa
NCBI Gene Id 64343
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name 5-azacytidine induced 2
Alias Symbols AZ2, NAP1, TILP
Peptide Sequence Synthetic peptide located within the following region: HGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target AZI2, or NAP1, contributes to the activation of NFKB (see MIM 164011)-dependent gene expression by activating IKK-related kinases, such as NAK.
Protein Interactions TBK1; UBC; AZI2; TBKBP1; IKBKE; TXLNA; MIB1; TXLNG; MTPAP; RNF31; CALCOCO2; N4BP1; APBA3; TRAF3; TICAM1; ODC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AZI2 (ARP62739_P050) antibody
Blocking Peptide For anti-AZI2 (ARP62739_P050) antibody is Catalog # AAP62739
Uniprot ID Q9H6S1
Protein Name 5-azacytidine-induced protein 2
Protein Accession # NP_071906
Purification Affinity Purified
Nucleotide Accession # NM_022461
Tested Species Reactivity Human
Gene Symbol AZI2
Predicted Species Reactivity Human, Rat, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 93%; Horse: 93%; Human: 100%; Pig: 86%; Rabbit: 77%; Rat: 79%
Image 1
Human 721_B
WB Suggested Anti-AZI2 Antibody
Titration: 1.0 ug/ml
Positive Control: 721_B Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com