| Product Number |
ARP62697_P050-Biotin |
| Product Page |
www.avivasysbio.com/nudt2-antibody-middle-region-biotin-arp62697-p050-biotin.html |
| Name |
NUDT2 Antibody - middle region : Biotin (ARP62697_P050-Biotin) |
| Protein Size (# AA) |
147 amino acids |
| Molecular Weight |
16kDa |
| Conjugation |
Biotin |
| NCBI Gene Id |
318 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nudix (nucleoside diphosphate linked moiety X)-type motif 2 |
| Alias Symbols |
APAH1 |
| Peptide Sequence |
Synthetic peptide located within the following region: ETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. |
| Protein Interactions |
MCM6; UBC; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-NUDT2 (ARP62697_P050-Biotin) antibody |
| Blocking Peptide |
For anti-NUDT2 (ARP62697_P050-Biotin) antibody is Catalog # AAP62697 |
| Uniprot ID |
P50583 |
| Protein Name |
Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] |
| Protein Accession # |
NP_671702 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_147173 |
| Gene Symbol |
NUDT2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%; Zebrafish: 100% |
| Image 1 | |
|
