Product Number |
ARP62697_P050 |
Product Page |
www.avivasysbio.com/nudt2-antibody-middle-region-arp62697-p050.html |
Name |
NUDT2 Antibody - middle region (ARP62697_P050) |
Protein Size (# AA) |
147 amino acids |
Molecular Weight |
16kDa |
NCBI Gene Id |
318 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Nudix (nucleoside diphosphate linked moiety X)-type motif 2 |
Alias Symbols |
APAH1 |
Peptide Sequence |
Synthetic peptide located within the following region: ETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. |
Protein Interactions |
MCM6; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NUDT2 (ARP62697_P050) antibody |
Blocking Peptide |
For anti-NUDT2 (ARP62697_P050) antibody is Catalog # AAP62697 |
Uniprot ID |
P50583 |
Protein Name |
Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] |
Protein Accession # |
NP_671702 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_147173 |
Tested Species Reactivity |
Human |
Gene Symbol |
NUDT2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%; Zebrafish: 100% |
Image 1 | Human 293T
| WB Suggested Anti-NUDT2 Antibody Titration: 1.0 ug/ml Positive Control: 293T Whole Cell |
|
|