NUDT2 Antibody - middle region (ARP62697_P050)

Data Sheet
 
Product Number ARP62697_P050
Product Page www.avivasysbio.com/nudt2-antibody-middle-region-arp62697-p050.html
Name NUDT2 Antibody - middle region (ARP62697_P050)
Gene Symbol NUDT2
Alias Symbols APAH1, MGC10404
Protein Size (# AA) 147 amino acids
Molecular Weight 16kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 318
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Nudix (nucleoside diphosphate linked moiety X)-type motif 2
Peptide Sequence Synthetic peptide located within the following region: ETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYD
Description of Target This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene.
Protein Interactions MCM6; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NUDT2 (ARP62697_P050) antibody
Blocking Peptide For anti-NUDT2 (ARP62697_P050) antibody is Catalog # AAP62697
Complete computational species homology data Anti-NUDT2 (ARP62697_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NUDT2.
Swissprot Id P50583
Protein Name Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
Protein Accession # NP_671702
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NUDT2.
Nucleotide Accession # NM_147173
Replacement Item This antibody may replace item sc-173542 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%; Zebrafish: 100%
Image 1
Human 293T
WB Suggested Anti-NUDT2 Antibody
Titration: 1.0 ug/ml
Positive Control: 293T Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com