MRPS31 Antibody - N-terminal region (ARP62691_P050)

• Product Number: ARP62691_P050
• Name: MRPS31 Antibody - N-terminal region (ARP62691_P050)
• Protein Size (# AA): 395 amino acids
• Molecular Weight: 43kDa
• NCBI Gene Id: 10240
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Mitochondrial ribosomal protein S31
• Alias Symbols: S31mt, IMOGN38, MRP-S31
• Peptide Sequence: Synthetic peptide located within the following region: LTVRHGTVRYRSSALLARTKNNIQRYFGTNSVICSKKDKQSVRTEETSKE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. The 28S subunit of the mammalian mitoribosome may play a crucial and characteristic role in translation initiation. This gene encodes a 28S subunit protein that has also been associated with type 1 diabetes; however, its relationship to the etiology of this disease remains to be clarified. Pseudogenes corresponding to this gene have been found on chromosomes 3 and 13.
• Protein Interactions: GRSF1; UBC; SMURF2; PARK2; STAT3; ESR2; SARNP; CPSF7; SRPRB; FLOT1; CUL3; ICT1; USP42; EIF6; LYST;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MRPS31 (ARP62691_P050) antibody is Catalog # AAP62691
• Uniprot ID: Q92665
• Protein Name: 28S ribosomal protein S31, mitochondrial
• Sample Type Confirmation:

  MRPS31 is strongly supported by BioGPS gene expression data to be expressed in HT1080

• Protein Accession #: NP_005821
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005830
• Tested Species Reactivity: Human
• Gene Symbol: MRPS31
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human HT1080
  
  WB Suggested Anti-MRPS31 Antibody
  Titration: 1.0 ug/ml
  Positive Control: HT1080 Whole CellMRPS31 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells