STN1 Antibody - C-terminal region (ARP62578_P050)

Data Sheet
 
Product Number ARP62578_P050
Product Page www.avivasysbio.com/stn1-antibody-c-terminal-region-arp62578-p050.html
Name STN1 Antibody - C-terminal region (ARP62578_P050)
Protein Size (# AA) 368 amino acids
Molecular Weight 40kDa
Subunit STN1
NCBI Gene Id 79991
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name STN1, CST complex subunit
Alias Symbols AAF44, OBFC1, AAF-44, RPA-32, bA541N10.2
Peptide Sequence Synthetic peptide located within the following region: DKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target OBFC1 and C17ORF68 (MIM 613129) are subunits of an alpha accessory factor (AAF) that stimulates the activity of DNA polymerase-alpha-primase (see MIM 176636), the enzyme that initiates DNA replication (Casteel et al., 2009 [PubMed 19119139]). OBFC1 also appears to function in a telomere-associated complex with C17ORF68 and TEN1 (C17ORF106; MIM 613130) (Miyake et al., 2009 [PubMed 19854130]).[supplied by OMIM, Nov 2009]
Protein Interactions LDLRAP1; TPP1; MVP; APP; UBD; UBC; MED8; MED30; MED25; MED29; MED9; MED4; MED16; MED6; MED13; MED12; MED24; MED27; MED17; MED23; MED14; MED1; POLR2A; RCOR1; TUBGCP4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-STN1 (ARP62578_P050) antibody
Blocking Peptide For anti-STN1 (ARP62578_P050) antibody is Catalog # AAP62578
Uniprot ID Q9H668
Protein Name CST complex subunit STN1
Protein Accession # NP_079204
Purification Affinity Purified
Nucleotide Accession # NM_024928
Tested Species Reactivity Human
Gene Symbol STN1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 79%
Image 1
Human Fetal heart
WB Suggested Anti-OBFC1 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com