PPP6C Antibody - N-terminal region (ARP62420_P050)

Data Sheet
 
Product Number ARP62420_P050
Product Page www.avivasysbio.com/ppp6c-antibody-n-terminal-region-arp62420-p050.html
Name PPP6C Antibody - N-terminal region (ARP62420_P050)
Protein Size (# AA) 283 amino acids
Molecular Weight 31kDa
NCBI Gene Id 5537
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Protein phosphatase 6, catalytic subunit
Alias Symbols PP6, PP6C
Peptide Sequence Synthetic peptide located within the following region: GNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes the catalytic subunit of protein phosphatase, a component of a signaling pathway regulating cell cycle progression. Splice variants encoding different protein isoforms exist. The pseudogene of this gene is located on chromosome X.
Protein Interactions UBC; AURKB; AURKA; RNF2; rev; SRRT; USP7; ACLY; ANKRD52; TIPRL; MOB1B; ANKRD44; TUBB6; PPP6R3; MOB1A; FBXO6; ANKRD28; PPP6R1; PPP6R2; ARHGEF2; PRKDC; IGBP1; EGFR; METTL21B; NOS2; VCP; MAP3K7; BRCA1; ELAVL1; PIDD1; TAB2; MYC; NFKBIE; TGFBR1; TBK1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PPP6C (ARP62420_P050) antibody
Blocking Peptide For anti-PPP6C (ARP62420_P050) antibody is Catalog # AAP62420
Uniprot ID O00743-2
Protein Name Serine/threonine-protein phosphatase 6 catalytic subunit
Sample Type Confirmation

PPP6C is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_001116841
Purification Affinity Purified
Nucleotide Accession # NM_001123369
Tested Species Reactivity Human
Gene Symbol PPP6C
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Image 1
Human HepG2
WB Suggested Anti-PPP6C Antibody
Titration: 1.0 ug/ml
Positive Control: HepG2 Whole CellPPP6C is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com