| Product Number |
ARP62385_P050 |
| Product Page |
https://www.avivasysbio.com/eif3d-antibody-n-terminal-region-arp62385-p050.html |
| Name |
Eif3d Antibody - N-terminal region (ARP62385_P050) |
| Protein Size (# AA) |
548 amino acids |
| Molecular Weight |
60kDa |
| Subunit |
D |
| NCBI Gene Id |
362952 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Eukaryotic translation initiation factor 3, subunit D |
| Alias Symbols |
Eif3s7 |
| Peptide Sequence |
Synthetic peptide located within the following region: SGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Eif3d is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. |
| Protein Interactions |
Sumo3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Eif3d (ARP62385_P050) antibody |
| Blocking Peptide |
For anti-Eif3d (ARP62385_P050) antibody is Catalog # AAP62385 |
| Uniprot ID |
Q6AYK8 |
| Protein Name |
Eukaryotic translation initiation factor 3 subunit D |
| Protein Accession # |
NP_001004283 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001004283 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Eif3d |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 100% |
| Image 1 | Rat Liver
 | WB Suggested Anti-Eif3d Antibody
Titration: 1.0 ug/ml
Positive Control: Rat liver |
|
|
