PFDN4 Antibody - N-terminal region (ARP62352_P050)

Data Sheet
 
Product Number ARP62352_P050
Product Page www.avivasysbio.com/pfdn4-antibody-n-terminal-region-arp62352-p050.html
Name PFDN4 Antibody - N-terminal region (ARP62352_P050)
Protein Size (# AA) 134 amino acids
Molecular Weight 15kDa
NCBI Gene Id 5203
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Prefoldin subunit 4
Alias Symbols C1, PFD4
Peptide Sequence Synthetic peptide located within the following region: ATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLED
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils.
Protein Interactions FBXW11; VBP1; UBC; RAN; PFDN2; MAPK7; METTL21B; PDRG1; PFDN6; SORD; PFDN5; PFDN1; ABL1; TUBA3E; SPATA2; PRPF4; TUBB; TUBA4A; ACTB; STAP1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PFDN4 (ARP62352_P050) antibody
Blocking Peptide For anti-PFDN4 (ARP62352_P050) antibody is Catalog # AAP62352
Uniprot ID Q9NQP4
Protein Name Prefoldin subunit 4
Sample Type Confirmation

PFDN4 is strongly supported by BioGPS gene expression data to be expressed in MDA-MB435

Protein Accession # NP_002614
Purification Affinity Purified
Nucleotide Accession # NM_002623
Tested Species Reactivity Human
Gene Symbol PFDN4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Image 1
Human MDA-MB435
WB Suggested Anti-PFDN4 Antibody
Titration: 1.0 ug/ml
Positive Control: MDA-MB-435S Whole CellPFDN4 is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com