FLJ43806 Antibody - C-terminal region (ARP62120_P050)

Data Sheet
 
Product Number ARP62120_P050
Product Page www.avivasysbio.com/flj43806-antibody-c-terminal-region-arp62120-p050.html
Name FLJ43806 Antibody - C-terminal region (ARP62120_P050)
Protein Size (# AA) 222 amino acids
Molecular Weight 24kDa
NCBI Gene Id 399563
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Hypothetical protein FLJ43806
Alias Symbols RP1-21O18.1
Peptide Sequence Synthetic peptide located within the following region: ASSVTRAGKEENSSGLKYKAGRLPLGKIGRGFSSKDPDFHDDYGSLQNED
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FLJ43806 (ARP62120_P050) antibody
Blocking Peptide For anti-FLJ43806 (ARP62120_P050) antibody is Catalog # AAP62120
Uniprot ID Q674X7
Protein Name Kazrin
Protein Accession # NP_963922
Purification Affinity Purified
Nucleotide Accession # NM_201628
Tested Species Reactivity Human
Gene Symbol FLJ43806
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 85%; Human: 100%; Rabbit: 93%; Rat: 93%
Image 1
Human A549
WB Suggested Anti-FLJ43806 Antibody
Titration: 1.0 ug/ml
Positive Control: A549 Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com