CCRL1 Antibody - C-terminal region (ARP62100_P050)

• Product Number: ARP62100_P050
• Name: CCRL1 Antibody - C-terminal region (ARP62100_P050)
• Protein Size (# AA): 350 amino acids
• Molecular Weight: 39kDa
• NCBI Gene Id: 51554
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chemokine (C-C motif) receptor-like 1
• Alias Symbols: PPR1, CCBP2, CCR10, CCR11, CCRL1, VSHK1, CCR-11, CKR-11, CCX CKR, CCX-CKR, CC-CKR-11
• Peptide Sequence: Synthetic peptide located within the following region: PILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSEGPTEPTSTFS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is a member of the G protein-coupled receptor family, and is a receptor for C-C type chemokines. This receptor has been shown to bind dendritic cell- and T cell-activated chemokines including CCL19/ELC, CCL21/SLC, and CCL25/TECK. Alternatively spliced transcript variants encoding the same protein have been described.
• Protein Interactions: CDK2; CXCL13; CCL21; CCL25; CCL8; CCL19; CCL13; CCL11; CCL5; CCL7; CCL2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ACKR4 (ARP62100_P050) antibody is Catalog # AAP62100
• Uniprot ID: Q9NPB9
• Protein Name: C-C chemokine receptor type 11
• Protein Accession #: NP_057641
• Purification: Affinity Purified
• Nucleotide Accession #: NM_016557
• Tested Species Reactivity: Human
• Gene Symbol: ACKR4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
• Image 1: Human 721_B
  
  WB Suggested Anti-CCRL1 Antibody
  Titration: 1.0 ug/ml
  Positive Control: 721_B Whole Cell