BAG5 Antibody - C-terminal region (ARP61996_P050)

Data Sheet
 
Product Number ARP61996_P050
Product Page www.avivasysbio.com/bag5-antibody-c-terminal-region-arp61996-p050.html
Name BAG5 Antibody - C-terminal region (ARP61996_P050)
Protein Size (# AA) 488 amino acids
Molecular Weight 56kDa
NCBI Gene Id 9529
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name BCL2-associated athanogene 5
Alias Symbols BAG-5
Peptide Sequence Synthetic peptide located within the following region: LEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEEL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. Three transcript variants encoding two different isoforms have been found for this gene.
Protein Interactions CCDC155; FAM118B; THAP1; BANP; MAD1L1; TP53; TRIM27; FAM96B; MAD2L1; DLG5; UBC; LATS2; SOX2; MMS19; CIRBP; LRRK2; CUL3; FBXO25; PARK2; HSPA4; SNCA; STUB1; OTUD4; UIMC1; BAG5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BAG5 (ARP61996_P050) antibody
Blocking Peptide For anti-BAG5 (ARP61996_P050) antibody is Catalog # AAP61996 (Previous Catalog # AAPP48333)
Uniprot ID Q9UL15-2
Protein Name BAG family molecular chaperone regulator 5
Publications

A novel mutant p53 binding partner BAG5 stabilizes mutant p53 and promotes mutant p53 GOFs in tumorigenesis. Cell Discov. 2, 16039 (2016). 27807478

Sample Type Confirmation

BAG5 is supported by BioGPS gene expression data to be expressed in HeLa

Protein Accession # NP_001015049
Purification Affinity Purified
Nucleotide Accession # NM_001015049
Tested Species Reactivity Human
Gene Symbol BAG5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
Image 1
Human Fetal liver
WB Suggested Anti-BAG5 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Liver
Image 2
Human Hela
Host: Rabbit
Target Name: BAG5
Sample Type: Human Hela
Antibody Dilution: 1.0ug/mlBAG5 is supported by BioGPS gene expression data to be expressed in HeLa
Image 3
siRUVBL1 transfected human Saos2
Sample Type:
Lane 1: 20ug siRUVBL1 transfected human Saos2 cells Lane 2: 20ug untransfected human Saos2 cells Primary Antibody Dilution:
1:1000 Secondary Antibody:
Anti-rabbit-HRP Secondary Antibody Dilution:
1:3000 Color/Signal Descriptions:
BAG5 Gene Name:
Wenwei Hu, Xuetian Yue, Rutgers Cancer Institute of New Jersey. Submitted by:
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com