| Product Number |
ARP61755_P050 |
| Product Page |
www.avivasysbio.com/tbce-antibody-n-terminal-region-arp61755-p050.html |
| Name |
Tbce Antibody - N-terminal region (ARP61755_P050) |
| Protein Size (# AA) |
524 amino acids |
| Molecular Weight |
59kDa |
| NCBI Gene Id |
70430 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tubulin-specific chaperone E |
| Alias Symbols |
pmn, 2610206D02Rik, C530005D02Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: GLWLGVEWDNPERGKHDGSHEGTMYFKCRHPTGGSFVRPSKVNFGDDFLT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Tbce is a rubulin-folding protein; it is involved in the second step of the tubulin folding pathway. Tbce seems to be implicated in the maintenance of the neuronal microtubule network. Tbce is involved in regulation of tubulin heterodimer dissociation. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Tbce (ARP61755_P050) antibody |
| Blocking Peptide |
For anti-Tbce (ARP61755_P050) antibody is Catalog # AAP61755 |
| Uniprot ID |
Q8CIV8 |
| Protein Name |
Tubulin-specific chaperone E |
| Protein Accession # |
NP_848027 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_178337 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Tbce |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 92% |
| Image 1 | Mouse Liver
 | WB Suggested Anti-Tbce Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Liver |
|
|
