UBE2V1 Antibody - C-terminal region (ARP61716_P050)

Data Sheet
 
Product Number ARP61716_P050
Product Page www.avivasysbio.com/ube2v1-antibody-c-terminal-region-arp61716-p050.html
Product Name UBE2V1 Antibody - C-terminal region (ARP61716_P050)
Size 100 ul
Gene Symbol UBE2V1
Alias Symbols CIR1, CROC-1, CROC1, UBE2V, UEV-1, UEV1, UEV1A
Protein Size (# AA) 147 amino acids
Molecular Weight 16kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 7335
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Ubiquitin-conjugating enzyme E2 variant 1
Peptide Sequence Synthetic peptide located within the following region: GVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN
Description of Target Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Multiple alternatively spliced transcripts encoding different isoforms have been described for this gene. A pseudogene has been identified which is also located on chromosome 20. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.
Protein Interactions UBC; TRAF6; ube2nb; UBQLN1; FAM168A; TRAF3IP2; STUB1; PARK2; TXNDC5; YWHAQ; ECHS1; YWHAZ; YWHAG; TGM2; LDHB; SFN; G6PD; IQCB1; PELI3; ULK4; POMP; UBXN7; UBE2C; AHCYL1; SSSCA1; UBE4B; TTC9C; ATP6V1G1; ATP6V1F; ZYX; UGDH; UCHL3; UBE2V2; UBE2N; UBE2D2; UBE2B
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-UBE2V1 (ARP61716_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-UBE2V1 (ARP61716_P050) antibody is Catalog # AAP61716 (Previous Catalog # AAPP48229)
Complete computational species homology data Anti-UBE2V1 (ARP61716_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express UBE2V1.
Swissprot Id Q13404
Protein Name Ubiquitin-conjugating enzyme E2 variant 1
Protein Accession # NP_001027459
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express UBE2V1.
Nucleotide Accession # NM_001032288
Replacement Item This antibody may replace item sc-15269 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Fetal Brain
WB Suggested Anti-UBE2V1 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Brain
Image 2
Human Jurkat Whole Cell
Host: Rabbit
Target Name: UBE2V1
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com