| Product Number |
ARP61683_P050-FITC |
| Product Page |
www.avivasysbio.com/scarb2-antibody-c-terminal-region-fitc-arp61683-p050-fitc.html |
| Name |
SCARB2 Antibody - C-terminal region : FITC (ARP61683_P050-FITC) |
| Protein Size (# AA) |
478 amino acids |
| Molecular Weight |
50kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
950 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
AMRF, EPM4, LGP85, CD36L2, HLGP85, LIMP-2, LIMPII, SR-BII |
| Peptide Sequence |
Synthetic peptide located within the following region: KSMINTTLIITNIPYIIMALGVFFGLVFTWLACKGQGSMDEGTADERAPL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
The protein encoded by this gene is a type III glycoprotein that is located primarily in limiting membranes of lysosomes and endosomes. Earlier studies in mice and rat suggested that this protein may participate in membrane transportation and the reorganization of endosomal/lysosomal compartment. The protein deficiency in mice was reported to impair cell membrane transport processes and cause pelvic junction obstruction, deafness, and peripheral neuropathy. Further studies in human showed that this protein is a ubiquitously expressed protein and that it is involved in the pathogenesis of HFMD (hand, foot, and mouth disease) caused by enterovirus-71 and possibly by coxsackievirus A16. Mutations in this gene caused an autosomal recessive progressive myoclonic epilepsy-4 (EPM4), also known as action myoclonus-renal failure syndrome (AMRF). |
| Protein Interactions |
UBC; ATP4A; TAF15; NONO; HSPD1; DDX1; ATP6V1B1; Ap1g1; AP3S2; AP3S1; THBS1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SCARB2 (ARP61683_P050-FITC) antibody |
| Blocking Peptide |
For anti-SCARB2 (ARP61683_P050-FITC) antibody is Catalog # AAP61683 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SCARB2 |
| Uniprot ID |
Q14108 |
| Protein Name |
Lysosome membrane protein 2 |
| Protein Accession # |
NP_005497 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005506 |
| Gene Symbol |
SCARB2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92% |
| Image 1 | |
|
