| Product Number |
ARP61682_P050 |
| Product Page |
www.avivasysbio.com/scarb2-antibody-n-terminal-region-arp61682-p050.html |
| Name |
SCARB2 Antibody - N-terminal region (ARP61682_P050) |
| Protein Size (# AA) |
478 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
950 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Scavenger receptor class B, member 2 |
| Alias Symbols |
AMRF, EPM4, LGP85, CD36L2, HLGP85, LIMP-2, LIMPII, SR-BII |
| Peptide Sequence |
Synthetic peptide located within the following region: VARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a type III glycoprotein that is located primarily in limiting membranes of lysosomes and endosomes. Earlier studies in mice and rat suggested that this protein may participate in membrane transportation and the reorganization of endosomal/lysosomal compartment. The protein deficiency in mice was reported to impair cell membrane transport processes and cause pelvic junction obstruction, deafness, and peripheral neuropathy. Further studies in human showed that this protein is a ubiquitously expressed protein and that it is involved in the pathogenesis of HFMD (hand, foot, and mouth disease) caused by enterovirus-71 and possibly by coxsackievirus A16. Mutations in this gene caused an autosomal recessive progressive myoclonic epilepsy-4 (EPM4), also known as action myoclonus-renal failure syndrome (AMRF). |
| Protein Interactions |
UBC; ATP4A; TAF15; NONO; HSPD1; DDX1; ATP6V1B1; Ap1g1; AP3S2; AP3S1; THBS1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SCARB2 (ARP61682_P050) antibody |
| Blocking Peptide |
For anti-SCARB2 (ARP61682_P050) antibody is Catalog # AAP61682 (Previous Catalog # AAPP47776) |
| Uniprot ID |
Q14108 |
| Protein Name |
Lysosome membrane protein 2 |
| Protein Accession # |
NP_005497 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005506 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SCARB2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 79% |
| Image 1 | Human THP-1
 | WB Suggested Anti-SCARB2 Antibody
Titration: 1.0 ug/ml
Positive Control: THP-1 Whole Cell |
|
|
