APOBEC3A Antibody - C-terminal region (ARP61579_P050)

• Product Number: ARP61579_P050
• Name: APOBEC3A Antibody - C-terminal region (ARP61579_P050)
• Protein Size (# AA): 199 amino acids
• Molecular Weight: 21kDa
• NCBI Gene Id: 100913187
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: APOBEC3A and APOBEC3B deletion hybrid
• Alias Symbols: A3A, APOBEC3A
• Peptide Sequence: Synthetic peptide located within the following region: AQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. The protein encoded by this gene lacks the zinc binding activity of other family members. The protein plays a role in immunity, by restricting transmission of foreign DNA such as viruses. One mechanism of foreign DNA restriction is deamination of foreign double-stranded DNA cytidines to uridines, which leads to DNA degradation. However, other mechanisms are also thought to be involved, as anti-viral effect is not dependent on deaminase activity. The protein encoded by this gene is the same as that encoded by APOBEC3A; however, this gene is a hybrid gene that results from the deletion of approximately 29.5 kb of sequence between the APOBEC3A gene and the adjacent gene APOBEC3B. The breakpoints of the deletion are within the two genes, so the deletion hybrid is predicted to have the promoter and coding region of APOBEC3A, but the 3' UTR of APOBEC3B.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-APOBEC3A (ARP61579_P050) antibody is Catalog # AAP61579
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ABC3A
• Uniprot ID: P31941
• Protein Name: probable DNA dC->dU-editing enzyme APOBEC-3A
• Protein Accession #: XP_005277017
• Purification: Affinity Purified
• Tested Species Reactivity: Human
• Gene Symbol: APOBEC3A
• Predicted Species Reactivity: Human, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 100%
• Image 1: Human Fetal Kidney
  
  Host: Rabbit
  Target Name: ABC3A
  Sample Type: Fetal Kidney lysates
  Antibody Dilution: 1ug/ml