Product Number |
ARP61493_P050 |
Product Page |
www.avivasysbio.com/sema4d-antibody-n-terminal-region-arp61493-p050.html |
Name |
SEMA4D Antibody - N-terminal region (ARP61493_P050) |
Protein Size (# AA) |
738 amino acids |
Molecular Weight |
81kDa |
NCBI Gene Id |
10507 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D |
Alias Symbols |
A8, GR3, BB18, CD100, COLL4, SEMAJ, coll-4, C9orf164, M-sema-G |
Peptide Sequence |
Synthetic peptide located within the following region: SEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
SEMA4D may play a functional role in the immune system, as well as in the nervous system. Induces B-cells to aggregate and improves their viability in vitro. |
Protein Interactions |
ELAVL1; SEMA4D; PLXNB1; PTPRC; CD72; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SEMA4D (ARP61493_P050) antibody |
Blocking Peptide |
For anti-SEMA4D (ARP61493_P050) antibody is Catalog # AAP61493 (Previous Catalog # AAPP47848) |
Uniprot ID |
Q92854-2 |
Protein Name |
Semaphorin-4D |
Protein Accession # |
NP_001135759 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001142287 |
Tested Species Reactivity |
Human |
Gene Symbol |
SEMA4D |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HeLa
| WB Suggested Anti-SEMA4D Antibody Titration: 1.0 ug/ml Positive Control: Hela Whole Cell |
|
|