SEMA4D Antibody - N-terminal region (ARP61493_P050)

Data Sheet
 
Product Number ARP61493_P050
Product Page www.avivasysbio.com/sema4d-antibody-n-terminal-region-arp61493-p050.html
Name SEMA4D Antibody - N-terminal region (ARP61493_P050)
Protein Size (# AA) 738 amino acids
Molecular Weight 81kDa
NCBI Gene Id 10507
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
Alias Symbols A8, GR3, BB18, CD100, COLL4, SEMAJ, coll-4, C9orf164, M-sema-G
Peptide Sequence Synthetic peptide located within the following region: SEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target SEMA4D may play a functional role in the immune system, as well as in the nervous system. Induces B-cells to aggregate and improves their viability in vitro.
Protein Interactions ELAVL1; SEMA4D; PLXNB1; PTPRC; CD72;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SEMA4D (ARP61493_P050) antibody
Blocking Peptide For anti-SEMA4D (ARP61493_P050) antibody is Catalog # AAP61493 (Previous Catalog # AAPP47848)
Uniprot ID Q92854-2
Protein Name Semaphorin-4D
Protein Accession # NP_001135759
Purification Affinity Purified
Nucleotide Accession # NM_001142287
Tested Species Reactivity Human
Gene Symbol SEMA4D
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Image 1
Human HeLa
WB Suggested Anti-SEMA4D Antibody
Titration: 1.0 ug/ml
Positive Control: Hela Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com