SEMA4D Antibody - N-terminal region (ARP61493_P050)

Data Sheet
 
Product Number ARP61493_P050
Product Page www.avivasysbio.com/sema4d-antibody-n-terminal-region-arp61493-p050.html
Product Name SEMA4D Antibody - N-terminal region (ARP61493_P050)
Size 100 ul
Gene Symbol SEMA4D
Alias Symbols C9orf164, CD100, FLJ33485, FLJ34282, FLJ39737, FLJ46484, M-sema-G, MGC169138, MGC169141, SEMAJ, coll-4
Protein Size (# AA) 738 amino acids
Molecular Weight 81kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 10507
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
Peptide Sequence Synthetic peptide located within the following region: SEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLN
Description of Target SEMA4D may play a functional role in the immune system, as well as in the nervous system. Induces B-cells to aggregate and improves their viability in vitro.
Protein Interactions ELAVL1; SEMA4D; PLXNB1; PTPRC; CD72;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-SEMA4D (ARP61493_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-SEMA4D (ARP61493_P050) antibody is Catalog # AAP61493 (Previous Catalog # AAPP47848)
Complete computational species homology data Anti-SEMA4D (ARP61493_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SEMA4D.
Swissprot Id Q92854-2
Protein Name Semaphorin-4D
Protein Accession # NP_001135759
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SEMA4D.
Nucleotide Accession # NM_001142287
Replacement Item This antibody may replace item sc-136250 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Image 1
Human HeLa
WB Suggested Anti-SEMA4D Antibody
Titration: 1.0 ug/ml
Positive Control: Hela Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com