BST2 Antibody - N-terminal region (ARP61461_P050)

Data Sheet
 
Product Number ARP61461_P050
Product Page www.avivasysbio.com/bst2-antibody-n-terminal-region-arp61461-p050.html
Name BST2 Antibody - N-terminal region (ARP61461_P050)
Protein Size (# AA) 180 amino acids
Molecular Weight 20kDa
NCBI Gene Id 684
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Bone marrow stromal cell antigen 2
Alias Symbols CD317, HM1.24, TETHERIN
Peptide Sequence Synthetic peptide located within the following region: RVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.
Protein Interactions vpu; HARS2; UBC; HAGH; TAB2; TAB1; MAP3K7; MYD88; BTRC; HGS; TFRC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for ARP61461_P050
Blocking Peptide Catalog # AAP61461
Uniprot ID Q10589
Protein Name Bone marrow stromal antigen 2
Protein Accession # NP_004326
Purification Affinity Purified
Nucleotide Accession # NM_004335
Tested Species Reactivity Human
Gene Symbol BST2
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Fetal Lung
WB Suggested Anti-BST2 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com