Product Number |
ARP61366_P050 |
Product Page |
www.avivasysbio.com/cysltr1-antibody-c-terminal-region-arp61366-p050.html |
Name |
CYSLTR1 Antibody - C-terminal region (ARP61366_P050) |
Protein Size (# AA) |
337 amino acids |
Molecular Weight |
37kDa |
NCBI Gene Id |
10800 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Cysteinyl leukotriene receptor 1 |
Alias Symbols |
CYSLT1, CYSLTR, CYSLT1R, HMTMF81 |
Peptide Sequence |
Synthetic peptide located within the following region: IIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The cysteinyl leukotrienes LTC4, LTD4, and LTE4 are important mediators of human bronchial asthma. Pharmacologic studies have determined that cysteinyl leukotrienes activate at least 2 receptors, the protein encoded by this gene and CYSLTR2. This encoded receptor is a member of the superfamily of G protein-coupled receptors. Activation of this receptor by LTD4 results in contraction and proliferation of smooth muscle, oedema, eosinophil migration and damage to the mucus layer in the lung. |
Protein Interactions |
CYSLTR2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CYSLTR1 (ARP61366_P050) antibody |
Blocking Peptide |
For anti-CYSLTR1 (ARP61366_P050) antibody is Catalog # AAP61366 |
Uniprot ID |
Q9Y271 |
Protein Name |
Cysteinyl leukotriene receptor 1 |
Protein Accession # |
NP_006630 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006639 |
Tested Species Reactivity |
Human |
Gene Symbol |
CYSLTR1 |
Predicted Species Reactivity |
Human, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Rabbit: 79% |
Image 1 | Human Fetal heart
| WB Suggested Anti-CYSLTR1 Antibody Titration: 1.0 ug/ml Positive Control: Fetal Heart |
|
|