CYSLTR1 Antibody - C-terminal region (ARP61366_P050)

Data Sheet
 
Product Number ARP61366_P050
Product Page www.avivasysbio.com/cysltr1-antibody-c-terminal-region-arp61366-p050.html
Name CYSLTR1 Antibody - C-terminal region (ARP61366_P050)
Protein Size (# AA) 337 amino acids
Molecular Weight 37kDa
NCBI Gene Id 10800
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cysteinyl leukotriene receptor 1
Alias Symbols CYSLT1, CYSLTR, CYSLT1R, HMTMF81
Peptide Sequence Synthetic peptide located within the following region: IIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The cysteinyl leukotrienes LTC4, LTD4, and LTE4 are important mediators of human bronchial asthma. Pharmacologic studies have determined that cysteinyl leukotrienes activate at least 2 receptors, the protein encoded by this gene and CYSLTR2. This encoded receptor is a member of the superfamily of G protein-coupled receptors. Activation of this receptor by LTD4 results in contraction and proliferation of smooth muscle, oedema, eosinophil migration and damage to the mucus layer in the lung.
Protein Interactions CYSLTR2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CYSLTR1 (ARP61366_P050) antibody
Blocking Peptide For anti-CYSLTR1 (ARP61366_P050) antibody is Catalog # AAP61366
Uniprot ID Q9Y271
Protein Name Cysteinyl leukotriene receptor 1
Protein Accession # NP_006630
Purification Affinity Purified
Nucleotide Accession # NM_006639
Tested Species Reactivity Human
Gene Symbol CYSLTR1
Predicted Species Reactivity Human, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Rabbit: 79%
Image 1
Human Fetal heart
WB Suggested Anti-CYSLTR1 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com