Product Number |
ARP61345_P050-FITC |
Product Page |
www.avivasysbio.com/efna2-antibody-middle-region-fitc-arp61345-p050-fitc.html |
Name |
EFNA2 Antibody - middle region : FITC (ARP61345_P050-FITC) |
Protein Size (# AA) |
213 amino acids |
Molecular Weight |
23kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
1943 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ephrin-A2 |
Alias Symbols |
ELF-1, EPLG6, LERK6, HEK7-L, LERK-6 |
Peptide Sequence |
Synthetic peptide located within the following region: YGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm. |
Protein Interactions |
BAP1; ADAM10; EPHA5; EPHA3; EPHA2; RUNX1; EPHA7; ZHX1; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-EFNA2 (ARP61345_P050-FITC) antibody |
Blocking Peptide |
For anti-EFNA2 (ARP61345_P050-FITC) antibody is Catalog # AAP61345 (Previous Catalog # AAPP48210) |
Uniprot ID |
O43921 |
Protein Name |
Ephrin-A2 |
Protein Accession # |
NP_001396 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001405 |
Gene Symbol |
EFNA2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 | |
|