GFER Antibody - C-terminal region : FITC (ARP61318_P050-FITC)

Data Sheet
 
Product Number ARP61318_P050-FITC
Product Page www.avivasysbio.com/gfer-antibody-c-terminal-region-fitc-arp61318-p050-fitc.html
Name GFER Antibody - C-terminal region : FITC (ARP61318_P050-FITC)
Protein Size (# AA) 205 amino acids
Molecular Weight 22kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 2671
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name growth factor, augmenter of liver regeneration
Alias Symbols ALR, HPO, HSS, ERV1, HPO1, HPO2, HERV1, MMCHD, MPMCD
Peptide Sequence Synthetic peptide located within the following region: LCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene.
Protein Interactions PLEKHF2; BNIPL; SMAD2; COPS5; COPS8; COPS2; GPS1; UBC; GFER; ASCC2; TXN;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-GFER (ARP61318_P050-FITC) antibody
Blocking Peptide For anti-GFER (ARP61318_P050-FITC) antibody is Catalog # AAP61318
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human ALR
Uniprot ID P55789
Protein Name FAD-linked sulfhydryl oxidase ALR
Protein Accession # NP_005253
Purification Affinity Purified
Gene Symbol GFER
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com