Asl Antibody - C-terminal region (ARP61235_P050)

• Product Number: ARP61235_P050
• Name: Asl Antibody - C-terminal region (ARP61235_P050)
• Protein Size (# AA): 464 amino acids
• Molecular Weight: 52kDa
• NCBI Gene Id: 109900
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Argininosuccinate lyase
• Alias Symbols: ASAL, 2510006M18Rik
• Peptide Sequence: Synthetic peptide located within the following region: MPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The function of this protein remains unknown.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Asl (ARP61235_P050) antibody is Catalog # AAP61235
• Uniprot ID: Q91YI0
• Protein Name: Argininosuccinate lyase
• Protein Accession #: NP_598529
• Purification: Affinity Purified
• Nucleotide Accession #: NM_133768
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: Asl
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
• Image 1: Mouse Liver
  
  WB Suggested Anti-Asl Antibody
  Titration: 1.0 ug/ml
  Positive Control: Mouse Liver
• Image 2: Human, Bovine
  
  Lanes:
  Lane1: 10 ug COS-7 cell lysate
  Lane2: 10 ug bovine aortic endothelial cell lysate
  Primary Antibody Dilution:
  1:1000
  Secondary Antibody:
  Anti-rabbit HRP
  Secondary Antibody Dilution:
  1:2000
  Gene Name:
  Asl
  Submitted by:
  Shawn Elms. Georgia Health Science University