XPA Antibody - C-terminal region (ARP61208_P050)

Data Sheet
 
Product Number ARP61208_P050
Product Page www.avivasysbio.com/xpa-antibody-c-terminal-region-arp61208-p050.html
Name XPA Antibody - C-terminal region (ARP61208_P050)
Protein Size (# AA) 273 amino acids
Molecular Weight 31kDa
NCBI Gene Id 7507
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Xeroderma pigmentosum, complementation group A
Alias Symbols XP1, XPAC
Peptide Sequence Synthetic peptide located within the following region: MKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a zinc finger protein involved in DNA excision repair. The encoded protein is part of the NER (nucleotide excision repair) complext which is responsible for repair of UV radiation-induced photoproducts and DNA adducts induced by chemical carcinogens. Mutations in this gene are associated with xeroderma pigmentosum complementation group A. Alternatively spliced transcript variants have been found for this gene.
Protein Interactions NDEL1; TRIM27; HERC2; ATR; PRKDC; ATM; HMGB1; ERCC1; DDB2; DDB1; RPA1; XPC; POLR2A; HHV8GK18_gp81; GTF2H1; ERCC6; RPA2; MSH3; MSH2; XAB2; GPN1; RPA4; RASSF1; GTF2E2; EP300;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-XPA (ARP61208_P050) antibody
Blocking Peptide For anti-XPA (ARP61208_P050) antibody is Catalog # AAP61208
Uniprot ID P23025
Protein Name DNA repair protein complementing XP-A cells
Protein Accession # NP_000371
Purification Affinity Purified
Nucleotide Accession # NM_000380
Tested Species Reactivity Human
Gene Symbol XPA
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Image 1
Human RPMI-8226
WB Suggested Anti-XPA Antibody
Titration: 1.0 ug/ml
Positive Control: RPMI-8226 Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com