| Product Number |
ARP61173_P050-HRP |
| Product Page |
www.avivasysbio.com/edn3-antibody-c-terminal-region-hrp-arp61173-p050-hrp.html |
| Name |
EDN3 Antibody - C-terminal region : HRP (ARP61173_P050-HRP) |
| Protein Size (# AA) |
219 amino acids |
| Molecular Weight |
24kDa |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
1908 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Endothelin 3 |
| Alias Symbols |
ET3, ET-3, WS4B, HSCR4, PPET3 |
| Peptide Sequence |
Synthetic peptide located within the following region: RYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVRGANRGLCQRRLKSRT |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Description of Target |
The protein encoded by this gene is a member of the endothelin family. Endothelins are endothelium-derived vasoactive peptides involved in a variety of biological functions. The active form of this protein is a 21 amino acid peptide processed from the precursor protein. The active peptide is a ligand for endothelin receptor type B (EDNRB). The interaction of this endothelin with EDNRB is essential for development of neural crest-derived cell lineages, such as melanocytes and enteric neurons. Mutations in this gene and EDNRB have been associated with Hirschsprung disease (HSCR) and Waardenburg syndrome (WS), which are congenital disorders involving neural crest-derived cells. Four alternatively spliced transcript variants encoding three distinct isoforms have been observed. |
| Protein Interactions |
EDNRB; EDNRA; CMA1; CTSE; KEL; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-EDN3 (ARP61173_P050-HRP) antibody |
| Blocking Peptide |
For anti-EDN3 (ARP61173_P050-HRP) antibody is Catalog # AAP61173 |
| Uniprot ID |
Q7Z6D2 |
| Protein Name |
Endothelin-3 |
| Sample Type Confirmation |
EDN3 is supported by BioGPS gene expression data to be expressed in PANC1 |
| Protein Accession # |
NP_996915 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_207032 |
| Gene Symbol |
EDN3 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | |
|
