EDN3 Antibody - C-terminal region (ARP61173_P050)

Data Sheet
 
Product Number ARP61173_P050
Product Page www.avivasysbio.com/edn3-antibody-c-terminal-region-arp61173-p050.html
Product Name EDN3 Antibody - C-terminal region (ARP61173_P050)
Size 100 ul
Gene Symbol EDN3
Alias Symbols ET3, MGC15067, MGC61498, ET-3, WS4B, HSCR4, PPET3
Protein Size (# AA) 219 amino acids
Molecular Weight 24kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 1908
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Endothelin 3
Peptide Sequence Synthetic peptide located within the following region: RYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVRGANRGLCQRRLKSRT
Description of Target The protein encoded by this gene is a member of the endothelin family. Endothelins are endothelium-derived vasoactive peptides involved in a variety of biological functions. The active form of this protein is a 21 amino acid peptide processed from the precursor protein. The active peptide is a ligand for endothelin receptor type B (EDNRB). The interaction of this endothelin with EDNRB is essential for development of neural crest-derived cell lineages, such as melanocytes and enteric neurons. Mutations in this gene and EDNRB have been associated with Hirschsprung disease (HSCR) and Waardenburg syndrome (WS), which are congenital disorders involving neural crest-derived cells. Four alternatively spliced transcript variants encoding three distinct isoforms have been observed.
Protein Interactions EDNRB; EDNRA; CMA1; CTSE; KEL;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-EDN3 (ARP61173_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-EDN3 (ARP61173_P050) antibody is Catalog # AAP61173
Complete computational species homology data Anti-EDN3 (ARP61173_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EDN3.
Swissprot Id Q7Z6D2
Protein Name Endothelin-3
Sample Type Confirmation

EDN3 is supported by BioGPS gene expression data to be expressed in PANC1

Protein Accession # NP_996915
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EDN3.
Nucleotide Accession # NM_207032
Tested Species Reactivity Human
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human PANC1
WB Suggested Anti-EDN3 Antibody
Titration: 1.0 ug/ml
Positive Control: PANC1 Whole CellEDN3 is supported by BioGPS gene expression data to be expressed in PANC1
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com