| Product Number |
ARP60993_P050-FITC |
| Product Page |
www.avivasysbio.com/cd34-antibody-c-terminal-region-fitc-arp60993-p050-fitc.html |
| Name |
CD34 Antibody - C-terminal region : FITC (ARP60993_P050-FITC) |
| Protein Size (# AA) |
328 amino acids |
| Molecular Weight |
35kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
947 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
CD34 molecule |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: DLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
CD34 is a monomeric cell surface antigen with a molecular mass of approximately 110 kD that is selectively expressed on human hematopoietic progenitor cells. |
| Protein Interactions |
CHST4; CRKL; PRKCD; ATF5; CREM; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-CD34 (ARP60993_P050-FITC) antibody |
| Blocking Peptide |
For anti-CD34 (ARP60993_P050-FITC) antibody is Catalog # AAP60993 (Previous Catalog # AAPP47131) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CD34 |
| Uniprot ID |
Q3C1E7 |
| Protein Name |
CD34 antigen EMBL BAE46748.1 |
| Protein Accession # |
NP_001764 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001773 |
| Gene Symbol |
CD34 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Goat, Guinea Pig, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Goat: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 77%; Pig: 93%; Rabbit: 93%; Rat: 77% |
| Image 1 | |
|
