Product Number |
ARP60993_P050 |
Product Page |
www.avivasysbio.com/cd34-antibody-c-terminal-region-arp60993-p050.html |
Name |
CD34 Antibody - C-terminal region (ARP60993_P050) |
Protein Size (# AA) |
328 amino acids |
Molecular Weight |
35kDa |
NCBI Gene Id |
947 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
CD34 molecule |
Description |
|
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: DLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
CD34 is a monomeric cell surface antigen with a molecular mass of approximately 110 kD that is selectively expressed on human hematopoietic progenitor cells. |
Protein Interactions |
CHST4; CRKL; PRKCD; ATF5; CREM; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CD34 (ARP60993_P050) antibody |
Blocking Peptide |
For anti-CD34 (ARP60993_P050) antibody is Catalog # AAP60993 (Previous Catalog # AAPP47131) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CD34 |
Uniprot ID |
Q3C1E7 |
Protein Name |
CD34 antigen EMBL BAE46748.1 |
Protein Accession # |
NP_001764 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001773 |
Tested Species Reactivity |
Human |
Gene Symbol |
CD34 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Goat, Guinea Pig, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Goat: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 77%; Pig: 93%; Rabbit: 93%; Rat: 77% |
Image 1 | Human THP-1 Whole Cell
| Host: Rabbit Target Name: CD34 Sample Tissue: Human THP-1 Whole Cell Antibody Dilution: 1ug/ml |
|
Image 2 | Human Fetal heart
| WB Suggested Anti-CD34 Antibody Titration: 1.0 ug/ml Positive Control: Fetal Heart |
|
Image 3 | Human kidney
| Sample Type: Human kidney Primary Antibody Dilution: 1:1000Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:5000Color/Signal Descriptions: Brown: CD34 Blue: DAPI Gene Name: CD34Submitted by: Christina Theodorpoulos, Queensland Univ. of Technology |
|