CD34 Antibody - C-terminal region (ARP60993_P050)

Data Sheet
 
Product Number ARP60993_P050
Product Page www.avivasysbio.com/cd34-antibody-c-terminal-region-arp60993-p050.html
Name CD34 Antibody - C-terminal region (ARP60993_P050)
Protein Size (# AA) 328 amino acids
Molecular Weight 35kDa
NCBI Gene Id 947
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name CD34 molecule
Description
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: DLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target CD34 is a monomeric cell surface antigen with a molecular mass of approximately 110 kD that is selectively expressed on human hematopoietic progenitor cells.
Protein Interactions CHST4; CRKL; PRKCD; ATF5; CREM;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CD34 (ARP60993_P050) antibody
Blocking Peptide For anti-CD34 (ARP60993_P050) antibody is Catalog # AAP60993 (Previous Catalog # AAPP47131)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CD34
Uniprot ID Q3C1E7
Protein Name CD34 antigen EMBL BAE46748.1
Protein Accession # NP_001764
Purification Affinity Purified
Nucleotide Accession # NM_001773
Tested Species Reactivity Human
Gene Symbol CD34
Predicted Species Reactivity Human, Mouse, Rat, Dog, Goat, Guinea Pig, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 86%; Goat: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 77%; Pig: 93%; Rabbit: 93%; Rat: 77%
Image 1
Human THP-1 Whole Cell
Host: Rabbit
Target Name: CD34
Sample Tissue: Human THP-1 Whole Cell
Antibody Dilution: 1ug/ml
Image 2
Human Fetal heart
WB Suggested Anti-CD34 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart
Image 3
Human kidney
Sample Type:
Human kidney
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit-HRP
Secondary Antibody Dilution:
1:5000
Color/Signal Descriptions:
Brown: CD34 Blue: DAPI
Gene Name:
CD34
Submitted by:
Christina Theodorpoulos, Queensland Univ. of Technology
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com