LYG2 Antibody - middle region (ARP60959_P050)

Data Sheet
 
Product Number ARP60959_P050
Product Page www.avivasysbio.com/lyg2-antibody-middle-region-arp60959-p050.html
Name LYG2 Antibody - middle region (ARP60959_P050)
Protein Size (# AA) 212 amino acids
Molecular Weight 23kDa
NCBI Gene Id 254773
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Lysozyme G-like 2
Alias Symbols LYGH, LYGA2, LYSG2
Peptide Sequence Synthetic peptide located within the following region: AAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene contains a SLT domain, a protein domain present in bacterial lytic transglycosylase (SLT) and in eukaryotic lysozymes (GEWL). SLT domain catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyglucosamine (GlcNAc).
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LYG2 (ARP60959_P050) antibody
Blocking Peptide For anti-LYG2 (ARP60959_P050) antibody is Catalog # AAP60959
Uniprot ID Q86SG7
Protein Name Lysozyme g-like protein 2
Protein Accession # NP_783862
Purification Affinity Purified
Nucleotide Accession # NM_175735
Tested Species Reactivity Human
Gene Symbol LYG2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Image 1
Human HepG2
WB Suggested Anti-LYG2 Antibody
Titration: 1.0 ug/ml
Positive Control: HepG2 Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com