| Product Number |
ARP60819_P050 |
| Product Page |
www.avivasysbio.com/adipor2-antibody-c-terminal-region-arp60819-p050.html |
| Name |
ADIPOR2 Antibody - C-terminal region (ARP60819_P050) |
| Protein Size (# AA) |
386 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
79602 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Adiponectin receptor 2 |
| Description |
|
| Alias Symbols |
PAQR2, ACDCR2 |
| Peptide Sequence |
Synthetic peptide located within the following region: FPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The adiponectin receptors, ADIPOR1 and ADIPOR2, serve as receptors for globular and full-length adiponectin and mediate increased AMPK and PPAR-alpha ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin. |
| Protein Interactions |
UBC; APPL1; ADIPOQ; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ADIPOR2 (ARP60819_P050) antibody |
| Blocking Peptide |
For anti-ADIPOR2 (ARP60819_P050) antibody is Catalog # AAP60819 |
| Uniprot ID |
Q86V24 |
| Protein Name |
Adiponectin receptor protein 2 |
| Publications |
Effects of Obesity on Adiponectin System Skin Expression in Dogs: A Comparative Study. Animals (Basel). 11, NULL (2021) |
| Protein Accession # |
NP_078827 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_024551 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ADIPOR2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Goat: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human Liver
 | Rabbit Anti-ADIPOR2 antibody
Catalog Number: ARP60819
Formalin Fixed Paraffin Embedded Tissue: Human Liver
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec |
|
| Image 2 | Human Placenta
 | Rabbit Anti-ADIPOR2 antibody
Catalog Number: ARP60819
Formalin Fixed Paraffin Embedded Tissue: Human Placenta
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec |
|
| Image 3 | Human heart
 | Rabbit Anti-ADIPOR2 Antibody
Catalog Number: ARP60819_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Plasma membrane in inner membranes
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
| Image 4 | Human OVCAR-3
 | WB Suggested Anti-ADIPOR2 Antibody
Titration: 1.0 ug/ml
Positive Control: OVCAR-3 Whole Cell |
|
