| Product Number |
ARP60814_P050 |
| Product Page |
www.avivasysbio.com/aacs-antibody-middle-region-arp60814-p050.html |
| Name |
Aacs Antibody - middle region (ARP60814_P050) |
| Protein Size (# AA) |
672 amino acids |
| Molecular Weight |
75kDa |
| NCBI Gene Id |
78894 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Acetoacetyl-CoA synthetase |
| Alias Symbols |
SUR5, 2210408B16Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: ASGELVCTKPIPCQPTHFWNDENGSKYRKAYFSKFPGVWAHGDYCRINPK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Aacs activates acetoacetate to acetoacetyl-CoA. It may be involved in utilizing ketone body for the fatty acid-synthesis during adipose tissue development. |
| Protein Interactions |
TRAF4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Aacs (ARP60814_P050) antibody |
| Blocking Peptide |
For anti-Aacs (ARP60814_P050) antibody is Catalog # AAP60814 |
| Uniprot ID |
Q9D2R0 |
| Protein Name |
Acetoacetyl-CoA synthetase |
| Protein Accession # |
NP_084486 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_030210 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Aacs |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 93%; Zebrafish: 86% |
| Image 1 | Mouse Thymus
 | WB Suggested Anti-Aacs Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Thymus |
|
|
