| Product Number |
ARP60753_P050 |
| Product Page |
www.avivasysbio.com/mia2-antibody-c-terminal-region-arp60753-p050.html |
| Name |
MIA2 Antibody - C-terminal region (ARP60753_P050) |
| Protein Size (# AA) |
654 amino acids |
| Molecular Weight |
74kDa |
| NCBI Gene Id |
117153 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Melanoma inhibitory activity 2 |
| Alias Symbols |
CTAGE5 |
| Peptide Sequence |
Synthetic peptide located within the following region: NTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSKPSVDT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
MIA2 may play a role in the pathophysiology of liver disease and may serve as a marker of liver damage. |
| Protein Interactions |
KHDRBS1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MIA2 (ARP60753_P050) antibody |
| Blocking Peptide |
For anti-MIA2 (ARP60753_P050) antibody is Catalog # AAP60753 (Previous Catalog # AAPP46946) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human MIA2 |
| Uniprot ID |
Q96PC5-2 |
| Protein Name |
Melanoma inhibitory activity protein 2 |
| Protein Accession # |
NP_473365 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_054024 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MIA2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human THP-1
 | WB Suggested Anti-MIA2 Antibody
Titration: 1.0 ug/ml
Positive Control: THP-1 Whole Cell |
|
|
