| Product Number |
ARP60748_P050 |
| Product Page |
www.avivasysbio.com/il27-antibody-c-terminal-region-arp60748-p050.html |
| Name |
IL27 Antibody - C-terminal region (ARP60748_P050) |
| Protein Size (# AA) |
243 amino acids |
| Molecular Weight |
27kDa |
| Subunit |
alpha |
| NCBI Gene Id |
246778 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Interleukin 27 |
| Alias Symbols |
p28, IL30, IL-27, IL27A, IL-27A, IL27p28 |
| Peptide Sequence |
Synthetic peptide located within the following region: AQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is one of the subunits of a heterodimeric cytokine complex. This protein is related to interleukin 12A (IL12A). It interacts with Epstein-Barr virus induced gene 3 (EBI3), a protein similar to interleukin 12B (IL12B), and forms a complex that has been shown to drive rapid expansion of naive but not memory CD4(+) T cells. The complex is also found to synergize strongly with interleukin 12 to trigger interferon gamma (IFNG) production of naive CD4(+) T cells. The biological effects of this cytokine are mediated by the class I cytokine receptor (WSX1/TCRR). |
| Protein Interactions |
IL27RA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-IL27 (ARP60748_P050) antibody |
| Blocking Peptide |
For anti-IL27 (ARP60748_P050) antibody is Catalog # AAP60748 (Previous Catalog # AAPP46941) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human IL27 |
| Uniprot ID |
Q8NEV9 |
| Protein Name |
Interleukin-27 subunit alpha |
| Protein Accession # |
NP_663634 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_145659 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
IL27 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Fetal Lung
 | WB Suggested Anti-IL27 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Lung |
|
|
