MRO Antibody - C-terminal region (ARP60588_P050)

• Product Number: ARP60588_P050
• Name: MRO Antibody - C-terminal region (ARP60588_P050)
• Protein Size (# AA): 262 amino acids
• Molecular Weight: 30kDa
• NCBI Gene Id: 83876
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Maestro
• Alias Symbols: B29, C18orf3
• Peptide Sequence: Synthetic peptide located within the following region: VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MRO (ARP60588_P050) antibody is Catalog # AAP60588 (Previous Catalog # AAPP46628)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MRO
• Uniprot ID: E9PAT5
• Protein Name: Protein maestro Ensembl ENSP00000397900
• Publications:

  The elusive MAESTRO gene: Its human reproductive tissue-specific expression pattern. PLoS ONE. 12, e0174873 (2017). 28406912

• Protein Accession #: NP_001120648
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001127176
• Tested Species Reactivity: Human
• Gene Symbol: MRO
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 90%; Rabbit: 85%; Rat: 77%
• Image 1: Human Jurkat
  
  WB Suggested Anti-MRO Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate