Product Number |
ARP60574_P050 |
Product Page |
www.avivasysbio.com/angptl6-antibody-c-terminal-region-arp60574-p050.html |
Name |
ANGPTL6 Antibody - C-terminal region (ARP60574_P050) |
Protein Size (# AA) |
470 amino acids |
Molecular Weight |
51 kDa |
NCBI Gene Id |
83854 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
angiopoietin-like 6 |
Alias Symbols |
AGF, ARP5 |
Peptide Sequence |
Synthetic peptide located within the following region: PESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
N/A |
Protein Interactions |
XRN1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for ARP60574_P050 |
Blocking Peptide |
Catalog # AAP60574 |
Immunogen |
The immunogen for Anti-ANGPTL6 antibody is: synthetic peptide directed towards the C-terminal region of Human ANGL6 |
Uniprot ID |
Q8NI99 |
Protein Name |
Angiopoietin-related protein 6 |
Protein Accession # |
NP_114123.2 |
Purification |
Affinity purified |
Tested Species Reactivity |
Human |
Gene Symbol |
ANGPTL6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Thymus Tumor
| Host: Rabbit Target Name: ANGL6 Sample Type: Thymus Tumor Antibody Dilution: 1.0ug/ml |
|
|