ANGPTL6 Antibody - C-terminal region (ARP60574_P050)

Data Sheet
 
Product Number ARP60574_P050
Product Page www.avivasysbio.com/angptl6-antibody-c-terminal-region-arp60574-p050.html
Name ANGPTL6 Antibody - C-terminal region (ARP60574_P050)
Protein Size (# AA) 470 amino acids
Molecular Weight 51 kDa
NCBI Gene Id 83854
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name angiopoietin-like 6
Alias Symbols AGF, ARP5
Peptide Sequence Synthetic peptide located within the following region: PESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference N/A
Protein Interactions XRN1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for ARP60574_P050
Blocking Peptide Catalog # AAP60574
Immunogen The immunogen for Anti-ANGPTL6 antibody is: synthetic peptide directed towards the C-terminal region of Human ANGL6
Uniprot ID Q8NI99
Protein Name Angiopoietin-related protein 6
Protein Accession # NP_114123.2
Purification Affinity purified
Tested Species Reactivity Human
Gene Symbol ANGPTL6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Thymus Tumor
Host: Rabbit
Target Name: ANGL6
Sample Type: Thymus Tumor
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com