NUDT22 Antibody - C-terminal region (ARP60482_P050)

Data Sheet
 
Product Number ARP60482_P050
Product Page www.avivasysbio.com/nudt22-antibody-c-terminal-region-arp60482-p050.html
Name NUDT22 Antibody - C-terminal region (ARP60482_P050)
Protein Size (# AA) 303 amino acids
Molecular Weight 32kDa
NCBI Gene Id 84304
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nudix (nucleoside diphosphate linked moiety X)-type motif 22
Alias Symbols MGC13045
Peptide Sequence Synthetic peptide located within the following region: FYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function remains unknown.
Protein Interactions AES; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NUDT22 (ARP60482_P050) antibody
Blocking Peptide For anti-NUDT22 (ARP60482_P050) antibody is Catalog # AAP60482 (Previous Catalog # AAPP46775)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NUDT22
Uniprot ID Q9BRQ3
Protein Name Nucleoside diphosphate-linked moiety X motif 22
Protein Accession # NP_115720
Purification Affinity Purified
Nucleotide Accession # NM_032344
Tested Species Reactivity Human
Gene Symbol NUDT22
Predicted Species Reactivity Human, Mouse, Rat, Cow, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 86%; Rat: 79%
Image 1
Human Fetal Kidney
WB Suggested Anti-NUDT22 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com