Product Number |
ARP60482_P050 |
Product Page |
www.avivasysbio.com/nudt22-antibody-c-terminal-region-arp60482-p050.html |
Name |
NUDT22 Antibody - C-terminal region (ARP60482_P050) |
Protein Size (# AA) |
303 amino acids |
Molecular Weight |
32kDa |
NCBI Gene Id |
84304 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Nudix (nucleoside diphosphate linked moiety X)-type motif 22 |
Alias Symbols |
MGC13045 |
Peptide Sequence |
Synthetic peptide located within the following region: FYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function remains unknown. |
Protein Interactions |
AES; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NUDT22 (ARP60482_P050) antibody |
Blocking Peptide |
For anti-NUDT22 (ARP60482_P050) antibody is Catalog # AAP60482 (Previous Catalog # AAPP46775) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human NUDT22 |
Uniprot ID |
Q9BRQ3 |
Protein Name |
Nucleoside diphosphate-linked moiety X motif 22 |
Protein Accession # |
NP_115720 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_032344 |
Tested Species Reactivity |
Human |
Gene Symbol |
NUDT22 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 86%; Rat: 79% |
Image 1 | Human Fetal Kidney
| WB Suggested Anti-NUDT22 Antibody Titration: 1.0 ug/ml Positive Control: Fetal kidney |
|
|