| Product Number |
ARP60369_P050 |
| Product Page |
www.avivasysbio.com/spred2-antibody-c-terminal-region-arp60369-p050.html |
| Name |
SPRED2 Antibody - C-terminal region (ARP60369_P050) |
| Protein Size (# AA) |
418 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
200734 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Sprouty-related, EVH1 domain containing 2 |
| Alias Symbols |
Spred-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: NHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
SPRED2 is a member of the Sprouty /SPRED family of proteins that regulate growth factor-induced activation of the MAP kinase cascade . |
| Protein Interactions |
SPG21; TOP3B; UBC; SQSTM1; NBR1; ELAVL1; RHOA; KIT; TESK1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SPRED2 (ARP60369_P050) antibody |
| Blocking Peptide |
For anti-SPRED2 (ARP60369_P050) antibody is Catalog # AAP60369 (Previous Catalog # AAPP46548) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SPRED2 |
| Uniprot ID |
Q7Z698 |
| Protein Name |
Sprouty-related, EVH1 domain-containing protein 2 |
| Sample Type Confirmation |
There is BioGPS gene expression data showing that SPRED2 is expressed in HepG2 |
| Protein Accession # |
NP_861449 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_181784 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SPRED2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human HepG2
 | WB Suggested Anti-SPRED2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that SPRED2 is expressed in HepG2 |
|
