LYZ Antibody - N-terminal region (ARP60298_P050)

Data Sheet
 
Product Number ARP60298_P050
Product Page www.avivasysbio.com/lyz-antibody-n-terminal-region-arp60298-p050.html
Name LYZ Antibody - N-terminal region (ARP60298_P050)
Protein Size (# AA) 148 amino acids
Molecular Weight 15kDa
NCBI Gene Id 4069
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Lysozyme
Alias Symbols LZM, LYZF1
Peptide Sequence Synthetic peptide located within the following region: CLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target LYZ is a human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the anti-microbial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. Missense mutations in LYZ have been identified in heritable renal amyloidosis.
Protein Interactions TP53; FUS; NEDD1; CEP57; AURKA; STAU1; SMAD6; UBC; GRK5; CRK; CLU; COPS6; CUL4B; CDK2; PARP11; USP25; USP1; LCN1; LTF; ELN; A2M; LRRK1; NME2; KHK;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LYZ (ARP60298_P050) antibody
Blocking Peptide For anti-LYZ (ARP60298_P050) antibody is Catalog # AAP60298 (Previous Catalog # AAPP46479)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LYZ
Uniprot ID P61626
Protein Name Lysozyme C
Protein Accession # NP_000230
Purification Affinity Purified
Nucleotide Accession # NM_000239
Tested Species Reactivity Human
Gene Symbol LYZ
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Goat: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Sheep: 93%
Image 1
Human heart
Rabbit Anti-LYZ Antibody
Catalog Number: ARP60298_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Plasma membrane
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 2
Human Heart
WB Suggested Anti-LYZ Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com