| Product Number |
ARP60242_P050 |
| Product Page |
www.avivasysbio.com/dok4-antibody-c-terminal-region-arp60242-p050.html |
| Name |
DOK4 Antibody - C-terminal region (ARP60242_P050) |
| Protein Size (# AA) |
326 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
55715 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Docking protein 4 |
| Alias Symbols |
IRS5, IRS-5 |
| Peptide Sequence |
Synthetic peptide located within the following region: GSQNIAEASSYAGEGYGAAQASSETDLLNRFILLKPKPSQGDSSEAKTPS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK4 functions in RET-mediated neurite outgrowth and plays a positive role in activation of the MAP kinase pathway |
| Protein Interactions |
BAG3; ERBB2; EGFR; ELAVL1; TEK; SRC; CRK; RET; INSR; IGF1R; RASA1; FYN; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DOK4 (ARP60242_P050) antibody |
| Blocking Peptide |
For anti-DOK4 (ARP60242_P050) antibody is Catalog # AAP60242 (Previous Catalog # AAPP46441) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DOK4 |
| Uniprot ID |
Q8TEW6 |
| Protein Name |
Docking protein 4 |
| Protein Accession # |
NP_060580 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018110 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DOK4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 77%; Rat: 100% |
| Image 1 | Human Heart
 | WB Suggested Anti-DOK4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart |
|
|
