CYP24A1 Antibody - C-terminal region (ARP60146_P050)

Data Sheet
 
Product Number ARP60146_P050
Product Page www.avivasysbio.com/cyp24a1-antibody-c-terminal-region-arp60146-p050.html
Product Name CYP24A1 Antibody - C-terminal region (ARP60146_P050)
Size 100 ul
Gene Symbol CYP24A1
Alias Symbols CP24, CYP24, MGC126273, MGC126274, P450-CC24, HCAI
Protein Size (# AA) 514 amino acids
Molecular Weight 55kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 1591
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Cytochrome P450, family 24, subfamily A, polypeptide 1
Description of Target This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protocol
The following related protocols are available on www.avivasysbio.com
Tips Information

See our General FAQ page.

Blocking Peptide For anti-CYP24A1 (ARP60146_P050) antibody is Catalog # AAP60146 (Previous Catalog # AAPP46279)
Datasheets/Manuals Printable datasheet for anti-CYP24A1 (ARP60146_P050) antibody
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CYP24A1
Complete computational species homology data Anti-CYP24A1 (ARP60146_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CYP24A1.
Peptide Sequence Synthetic peptide located within the following region: QVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAE
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Swissprot Id Q07973
Protein Name 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
Protein Accession # NP_000773
Purification Affinity Purified
Protein Interactions Dlg4; UBC;
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CYP24A1.
Nucleotide Accession # NM_000782
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Application WB, IHC, IHC-P, IHC-FFPE
Predicted Homology Based on Immunogen Sequence Dog: 79%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 86%
Image 1
Human MCF-7
WB Suggested Anti-CYP24A1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com