Product Number |
ARP60144_P050 |
Product Page |
www.avivasysbio.com/cyp21a2-antibody-c-terminal-region-arp60144-p050.html |
Name |
CYP21A2 Antibody - C-terminal region (ARP60144_P050) |
Protein Size (# AA) |
495 amino acids |
Molecular Weight |
56kDa |
NCBI Gene Id |
1589 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Cytochrome P450, family 21, subfamily A, polypeptide 2 |
Description |
|
Alias Symbols |
CAH1, CPS1, CA21H, CYP21, CYP21B, P450c21B |
Peptide Sequence |
Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates steroids at the 21 position. Its activity is required for the synthesis of steroid hormones including cortisol and aldosterone. Mutations in this gene cause congenital adrenal hyperplasia. A related pseudogene is located near this gene; gene conversion events involving the functional gene and the pseudogene are thought to account for many cases of steroid 21-hydroxylase deficiency. Two transcript variants encoding different isoforms have been found for this gene. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CYP21A2 (ARP60144_P050) antibody |
Blocking Peptide |
For anti-CYP21A2 (ARP60144_P050) antibody is Catalog # AAP60144 (Previous Catalog # AAPP46278) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CYP21A2 |
Uniprot ID |
Q16874 |
Protein Name |
Cytochrome P450 21-hydroxylase EMBL AAB67982.1 |
Publications |
Pregnancy-associated changes of peroxisome proliferator-activated receptor delta (PPARD) and cytochrome P450 family 21 subfamily A member 2 (CYP21A2) expression in the bovine corpus luteum. J Reprod Dev. 66, 205-213 (2020). 32037375 |
Protein Accession # |
NP_000491 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000500 |
Tested Species Reactivity |
Human, Monkey |
Gene Symbol |
CYP21A2 |
Predicted Species Reactivity |
Human, Cow, Dog, Guinea Pig, Pig, Sheep |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Guinea Pig: 80%; Human: 100%; Pig: 92%; Sheep: 92% |
Image 1 | Monkey adrenal gland
| Sample Type: Monkey adrenal gland Primary Antibody Dilution: 1:25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:1000 Color/Signal Descriptions: Brown: CYP21A2 Blue: Nucleus Gene Name: CYP21A2 Submitted by: Jonathan Bertin, Endoceutics Inc. |
|
Image 2 | Monkey vagina
| Sample Type: Monkey vagina Primary Antibody Dilution: 1:25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:1000 Color/Signal Descriptions: Brown: CYP21A2 Blue: Nucleus Gene Name: CYP21A2 Submitted by: Jonathan Bertin, Endoceutics Inc. |
|
Image 3 | Human Muscle
| WB Suggested Anti-CYP21A2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Muscle |
|