CYP21A2 Antibody - C-terminal region (ARP60144_P050)

Data Sheet
 
Product Number ARP60144_P050
Product Page www.avivasysbio.com/cyp21a2-antibody-c-terminal-region-arp60144-p050.html
Name CYP21A2 Antibody - C-terminal region (ARP60144_P050)
Protein Size (# AA) 495 amino acids
Molecular Weight 56kDa
NCBI Gene Id 1589
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cytochrome P450, family 21, subfamily A, polypeptide 2
Description
Alias Symbols CAH1, CPS1, CA21H, CYP21, CYP21B, P450c21B
Peptide Sequence Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates steroids at the 21 position. Its activity is required for the synthesis of steroid hormones including cortisol and aldosterone. Mutations in this gene cause congenital adrenal hyperplasia. A related pseudogene is located near this gene; gene conversion events involving the functional gene and the pseudogene are thought to account for many cases of steroid 21-hydroxylase deficiency. Two transcript variants encoding different isoforms have been found for this gene.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CYP21A2 (ARP60144_P050) antibody
Blocking Peptide For anti-CYP21A2 (ARP60144_P050) antibody is Catalog # AAP60144 (Previous Catalog # AAPP46278)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CYP21A2
Uniprot ID Q16874
Protein Name Cytochrome P450 21-hydroxylase EMBL AAB67982.1
Publications

Pregnancy-associated changes of peroxisome proliferator-activated receptor delta (PPARD) and cytochrome P450 family 21 subfamily A member 2 (CYP21A2) expression in the bovine corpus luteum. J Reprod Dev. 66, 205-213 (2020). 32037375

Protein Accession # NP_000491
Purification Affinity Purified
Nucleotide Accession # NM_000500
Tested Species Reactivity Human, Monkey
Gene Symbol CYP21A2
Predicted Species Reactivity Human, Cow, Dog, Guinea Pig, Pig, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 80%; Human: 100%; Pig: 92%; Sheep: 92%
Image 1
Monkey adrenal gland
Sample Type:
Monkey adrenal gland
Primary Antibody Dilution:
1:25
Secondary Antibody:
Anti-rabbit-HRP
Secondary Antibody Dilution:
1:1000
Color/Signal Descriptions:
Brown: CYP21A2 Blue: Nucleus
Gene Name:
CYP21A2
Submitted by:
Jonathan Bertin, Endoceutics Inc.
Image 2
Monkey vagina
Sample Type:
Monkey vagina
Primary Antibody Dilution:
1:25
Secondary Antibody:
Anti-rabbit-HRP
Secondary Antibody Dilution:
1:1000
Color/Signal Descriptions:
Brown: CYP21A2 Blue: Nucleus
Gene Name:
CYP21A2
Submitted by:
Jonathan Bertin, Endoceutics Inc.
Image 3
Human Muscle
WB Suggested Anti-CYP21A2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com