CTSC Antibody - middle region (ARP60116_P050)

Data Sheet
 
Product Number ARP60116_P050
Product Page www.avivasysbio.com/ctsc-antibody-middle-region-arp60116-p050.html
Name CTSC Antibody - middle region (ARP60116_P050)
Protein Size (# AA) 463 amino acids
Molecular Weight 8kDa
NCBI Gene Id 1075
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cathepsin C
Description
Alias Symbols JP, HMS, JPD, PLS, CPPI, DPP1, DPPI, PALS, DPP-I, PDON1
Peptide Sequence Synthetic peptide located within the following region: WTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target CTSC is a member of the peptidase C1 family, is a lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in immune/inflammatory cells. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor, and a residual portion of the propeptide acts as an intramolecular chaperone for the folding and stabilization of the mature enzyme. This enzyme requires chloride ions for activity and can degrade glucagon. Defects in CTSC have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis.
Protein Interactions SUMO1; UBC; NEDD8; ARMC9; ANKMY2; ARIH1; UBA2; ADSL; FBXO6; XRN2; CAPN1; CD81; CTSC; CTSL;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CTSC (ARP60116_P050) antibody
Blocking Peptide For anti-CTSC (ARP60116_P050) antibody is Catalog # AAP60116 (Previous Catalog # AAPP46256)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CTSC
Uniprot ID P53634
Protein Name Dipeptidyl peptidase 1
Publications

Cathepsin B Is Upregulated and Mediates ECM Degradation in Colon Adenocarcinoma HT29 Cells Overexpressing Snail. Cells. 8, (2019). 30818851

Protein Accession # NP_001805
Purification Affinity Purified
Nucleotide Accession # NM_001814
Tested Species Reactivity Human
Gene Symbol CTSC
Predicted Species Reactivity Human, Mouse, Cow, Dog, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 79%
Image 1
Human PANC1
WB Suggested Anti-CTSC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: PANC1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com